PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.953XL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TALE
Protein Properties Length: 386aa    MW: 42913.9 Da    PI: 6.437
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.953XLgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093123481955
                  HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Araip.953XL 312 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 348
                  45679*****************************885 PP

2ELK414e-14268289122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLkqEF+
  Araip.953XL 268 ELKGQLLRKYSGYLGSLKQEFM 289
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-19127171IPR005540KNOX1
PfamPF037905.6E-22128167IPR005540KNOX1
SMARTSM012568.3E-25179230IPR005541KNOX2
PfamPF037916.0E-21183229IPR005541KNOX2
PfamPF037896.5E-11268289IPR005539ELK domain
SMARTSM011882.8E-8268289IPR005539ELK domain
PROSITE profilePS5121311.174268288IPR005539ELK domain
PROSITE profilePS5007113.086288351IPR001356Homeobox domain
SuperFamilySSF466892.82E-19290365IPR009057Homeodomain-like
SMARTSM003891.2E-12290355IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-28293353IPR009057Homeodomain-like
CDDcd000861.96E-12300352No hitNo description
PfamPF059207.1E-17308347IPR008422Homeobox KN domain
PROSITE patternPS000270326349IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEAEGGSSNG GPSNCFMAFG ENNNSSSNNN NNSVSGSGLS PMMMMPLVTN SHHPTNNNLI  60
PHQNHTSTSN NIANLFLPMP TSNTNNNNTN TSFMLENNTT TTTTTTTGLG YYFMDNNGSS  120
SSSSPSSAVK AKIMAHPHYH RLLAAYINCQ KVGAPPEVVA RLEAACASAM SMAAAGDTSA  180
SCLGEDPSLD QFMEAYCEML TKYEQELSKP LKEAMIFLQR MESQFKNLTI SSSSRDLGSK  240
EANDGNNGSS EEDVDLQSLI DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE  300
ARQQLLEWWS RHYKWPYPSE SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVV  360
DPTHPHYYMD NVLANPFSMD LPNTML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283292LKQEFMKKRK
2289293KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196435.10.0PREDICTED: homeobox protein SBH1-like
SwissprotP466081e-168HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLO828051e-171O82805_PEA; Knotted1-like class I homeodomain protein
STRINGGLYMA09G01000.21e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-130KNOX/ELK homeobox transcription factor